missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18204321

Novus Biologicals™ FIH-1/HIF-1AN Recombinant Protein Antigen

Code produit 18204321 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantity:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18204321 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18204321 Fournisseur Novus Biologicals™ Code fournisseur NBP258365PEP
 Restricted Item
Estimated Shipment: 15-10-2026
Ajouter au panier
Ajouter au panier
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FIH-1/HIF-1AN. Source: E.coli Amino Acid Sequence: KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQE The FIH-1/HIF-1AN Recombinant Protein Antigen is derived from E. coli. The FIH-1/HIF-1AN Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 55662
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name FIH-1/HIF-1AN Recombinant Protein Antigen
Content And Storage Store at −20C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias DKFZp762F1811, EC 1.14.11.16, factor inhibiting HIF1, Factor inhibiting HIF-1, FIH1FIH-1, FLJ20615, FLJ22027, hypoxia inducible factor 1, alpha subunit inhibitor, hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase,
Gene Symbol HIF1AN
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51585. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.