missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FGF1 (Human) Recombinant Protein (P01)
Human FGF1 full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00002246-P01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis.
- Theoretical MW: 43.9kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
| NP_000791.1 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 43.9 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD | |
| AFGF/ECGF/ECGF-beta/ECGFA/ECGFB/FGF-alpha/FGFA/GLIO703/HBGF1 | |
| FGF1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 2246 | |
| FGF1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FGF1 | |
| Human | |
| Recombinant | |
| Solution |
For Research Use Only