missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FAU (Human) Recombinant Protein

Human FAU full-length ORF ( AAH33877, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002197-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16164861

  • 359.00€ / 10µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Specifications

Specifications

AAH33877
Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FAU
GST
2197
Wheat germ expression system
10 μg
FAU1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers