missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FAU (Human) Recombinant Protein

Human FAU full-length ORF ( AAH33877, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00002197-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16164861

Quantity
Estimated Shipment: 22-08-2022
to see stock.

Add to basket

Description

Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Specifications

Accession Number	AAH33877
Name	Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	FAU
Protein Tag	GST

Gene ID (Entrez)	2197
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	FAU1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30
Host Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description