missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ETNK1 Recombinant Protein

Name: Abnova&trade; ETNK1 Recombinant Protein
Brand: Abnova&trade;
SKU: 16161493
Price: 508.00 EUR

Brand: Abnova™ H00055500-P01.25ug

Additional Details : Weight : 0.00010kg

Codice prodotto. 16161493

Quantità

Estimated Shipment: 11-06-2024
to see stock.

Aggiungi al carrello

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Accession Number	AAH06111
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	44.22
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF
Gene Alias	EKI/EKI1/Nbla10396
Gene Symbol	ETNK1
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	55500
Name	ETNK1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	ETNK1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Suggerimenti di prodotto

Descrizione