missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EIF1AX Recombinant Protein

Name: Abnova&trade; EIF1AX Recombinant Protein
Brand: Abnova&trade;
SKU: 16194411
Price: 335.00 EUR

Brand: Abnova™ H00001964-P01.10ug

Additional Details : Weight : 0.00010kg

Artikelnummer. 16194411

Menge

Estimated Shipment: 07-06-2024
to see stock.

Zum Warenkorb hinzufügen

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Accession Number	AAH00793
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	41.58
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Gene Alias	EIF1A/EIF1AP1/EIF4C/eIF-1A/eIF-4C
Gene Symbol	EIF1AX
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	1964
Name	EIF1AX (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	EIF1AX
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Produktvorschläge

Beschreibung