missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DSCR1 (Human) Recombinant Protein

Name: Abnova&trade; DSCR1 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16164201
Price: 335.00 EUR

Human DSCR1 full-length ORF ( AAH02864, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001827-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16164201

Quantity

Estimated Shipment: 31-05-2024
to see stock.

Add to basket

Description

Sequence: MEEVDLRDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTQIHLS

Specifications

Accession Number	AAH02864
Name	regulator of calcineurin 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	RCAN1
Protein Tag	GST

Gene ID (Entrez)	1827
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	ADAPT78, CSP1, DSC1, DSCR1, MCIP1, RCN1
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description