missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CTHRC1 (Human) Recombinant Protein
Human CTHRC1 full-length ORF ( NP_612464.1, 1 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00115908-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Specifications
| NP_612464.1 | |
| collagen triple helix repeat containing 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 115908 | |
| Wheat germ expression system | |
| 25 μg | |
| CTHRC1 | |
| GST |