missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CETN2 (Human) Recombinant Protein

Human CETN2 full-length ORF ( AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001069-P01.10ug

Product Code. 16193121

Quantity

Estimated Shipment: 20-11-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Specifications

Accession Number	AAH05334
Name	centrin, EF-hand protein, 2
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CETN2
Protein Tag	GST

Gene ID (Entrez)	1069
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	CALT, CEN2
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description