missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BTC (Human) Recombinant Protein

Human BTC full-length ORF ( AAH11618, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000685-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16105344

  • 349.00€ / 10µg

Estimated Shipment: 12-07-2023
to see stock.
Add to basket

Description

Description

  • Sequence: MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICMIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Specifications

Specifications

AAH11618
betacellulin
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
685
Wheat germ expression system
10 μg
BTC
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers