missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAG1 Rabbit anti-Mouse, Rat, Porcine, Equine, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-74190
This item is not returnable.
View return policy
Description
RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
| RAG1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation | |
| P15919 | |
| RAG1 | |
| Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. | |
| Affinity Purified | |
| RUO | |
| 5896 | |
| Mouse, Rat, Porcine, Equine | |
| IgG |
| Western Blot, ChIP assay | |
| Unconjugated | |
| PBS & 2% Sucrose. with 0.09% Sodium Azide | |
| MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1 | |
| Rabbit | |
| 119 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?
For Research Use Only