missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AIG1 Recombinant Protein

Human AIG1 full-length ORF recombinant protein with GST-tag at N-terminal

Brand:  Abnova™ H00051390-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16159982

  • 545.00€ / 25µg

Estimated Shipment: 02-08-2022
to see stock.
Add to basket

Description

Description

  • Theoretical MW (kDa): 51.92
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MALVPCQALRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQERERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQHPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPF
LEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH25278
Solution
51390
AIG1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
AIG-1/DKFZp686F03136/FLJ10485/dJ95L4.1
AIG1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
51.92
8
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AIG1
Human
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers