missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGXT2L2. Source: E.coli Amino Acid Sequence: VLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGV The AGXT2L2 Recombinant Protein Antigen is derived from E. coli. The AGXT2L2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifikationer
Specifikationer
| Gene ID (Entrez) | 85007 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | AGXT2L2 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | alanine--glyoxylate aminotransferase 2-like 2, alanine-glyoxylate aminotransferase 2-like 2, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.13, EC 2.6.1.44, MGC117348, MGC15875, MGC45484 |
| Gene Symbol | AGXT2L2 |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Visa mer |
For Research Use Only.
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?