missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ACTC (Human) Recombinant Protein

Human ACTC full-length ORF ( AAH09978.1, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000070-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161211

  • 359.00€ / 10µg

Estimated Shipment: 29-07-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Specifications

Specifications

AAH09978.1
actin, alpha, cardiac muscle 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACTC1
GST
70
Wheat germ expression system
10 μg
ACTC, CMD1R, CMH11
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers