Filtered Search Results
Search results for "cell biology"
Tocris Bioscience™ DMSO, Cell Cryopreserve Grade
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Intracellular cryoprotective agent
| Content And Storage | -20°C |
|---|---|
| Form | Solid |
| Product Type | Proteinase K |
| Color | White |
| For Use With (Application) | Isolation of DNA and RNA from cell and tissue preparations, inactivating many Enzymes, including Endogenous Nucleases |
| Source | Tritirachium album |
Thermo Scientific™ ST8R Cell Culture Centrifuge Package
Meet both clinical and research protocol needs.
Thermo Scientific™ ST8 Cell Culture Centrifuge Package
Meet both clinical and research protocol needs.
2-Mercaptoethanol Cell Culture MP Biomedicals
CAS: 60-24-2 Molecular Formula: C2H6OS Molecular Weight (g/mol): 78.13 MDL Number: MFCD00004890 InChI Key: DGVVWUTYPXICAM-UHFFFAOYSA-N Synonym: 2-mercaptoethanol,mercaptoethanol,thioglycol,beta-mercaptoethanol,ethanol, 2-mercapto,2-thioethanol,2-hydroxy-1-ethanethiol,thioethylene glycol,2-hydroxyethanethiol,2-hydroxyethyl mercaptan PubChem CID: 1567 ChEBI: CHEBI:41218 IUPAC Name: 2-sulfanylethan-1-ol SMILES: OCCS
| PubChem CID | 1567 |
|---|---|
| CAS | 60-24-2 |
| Molecular Weight (g/mol) | 78.13 |
| ChEBI | CHEBI:41218 |
| MDL Number | MFCD00004890 |
| SMILES | OCCS |
| Synonym | 2-mercaptoethanol,mercaptoethanol,thioglycol,beta-mercaptoethanol,ethanol, 2-mercapto,2-thioethanol,2-hydroxy-1-ethanethiol,thioethylene glycol,2-hydroxyethanethiol,2-hydroxyethyl mercaptan |
| IUPAC Name | 2-sulfanylethan-1-ol |
| InChI Key | DGVVWUTYPXICAM-UHFFFAOYSA-N |
| Molecular Formula | C2H6OS |
D-myo-Inositol, 99.2%, Cell culture reagent, For HPLC analysis, MP Biomedicals™
CAS: 87-89-8 Molecular Formula: C6H12O6 Molecular Weight (g/mol): 180.156 MDL Number: MFCD00077932 InChI Key: CDAISMWEOUEBRE-UHFFFAOYSA-N Synonym: scyllo-inositol,myo-inositol,inositol,muco-inositol,epi-inositol,i-inositol,meso-inositol,allo-inositol,1d-chiro-inositol,myoinositol PubChem CID: 892 ChEBI: CHEBI:24848 IUPAC Name: cyclohexane-1,2,3,4,5,6-hexol SMILES: C1(C(C(C(C(C1O)O)O)O)O)O
| PubChem CID | 892 |
|---|---|
| CAS | 87-89-8 |
| Molecular Weight (g/mol) | 180.156 |
| ChEBI | CHEBI:24848 |
| MDL Number | MFCD00077932 |
| SMILES | C1(C(C(C(C(C1O)O)O)O)O)O |
| Synonym | scyllo-inositol,myo-inositol,inositol,muco-inositol,epi-inositol,i-inositol,meso-inositol,allo-inositol,1d-chiro-inositol,myoinositol |
| IUPAC Name | cyclohexane-1,2,3,4,5,6-hexol |
| InChI Key | CDAISMWEOUEBRE-UHFFFAOYSA-N |
| Molecular Formula | C6H12O6 |
Thermo Scientific™ Hanks' Balanced Salt Solution (HBSS) without Ca2+, Mg2+ for Pierce™ Primary Cell Isolation Kits
Easily isolate and culture highly viable functional primary cardiomyocytes
Carl Zeiss™ Primovert Microscope with Binocular Tube
Compact inverted routine microscope that combines efficiency and optical performance. This inverted microscope is configured for transmitted light brightfield and phase contrast. This system is ideal for cell culture, routine work and quick & easy imaging.
Cytiva™ Whatman™ Nuclepore™ Polycarbonate Track-Etched (PCTE) Cell Culture Membrane Filters (PVP-Free)
Made from high-quality polycarbonate track-etched (PCTE) film, Nuclepore™ PCTE Membranes offer highly defined pore size cutoffs for particle deformity measurement and capture of small particles. With high flow rates and excellent chemical/thermal resistance, these membranes are supplied PVP-free.
Tocris Bioscience™ Cell counting kit-8
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Cell viability and proliferation assay test solution
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | P23946 |
| Research Discipline | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Symbols | CMA1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C. Do not freeze. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P23946 |
| Research Discipline | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Symbols | CMA1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Immunogen | BALB/C mice were injected with a purified human skin chymase. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | This reacts with mast cells distributed in skin, synovium, lung and heart. |
| Clone | CC1 |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | CFFC1 factor, HCF, HCF1HFC1, HCF-1VP16 accessory protein, host cell factor C1 (VP16-accessory protein), MGC70925, VCAFhost cell factor 1 |
| Molecular Weight (g/mol) | 35.31 kDa |
| Gene ID (Entrez) | 3054 |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | HCFC1 |
| Research Category | Cell Biology, Cell Cycle and Replication, Endocrinology |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | Host Cell Factor 1/HCFC1 |