accessibility menu, dialog, popup

UserName

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

Show all

special offers

  • (4)
  • (1,241)
  • (22)

brands

  • (155)
  • (1,324)
  • (590)
  • (3)
  • (17)
  • (16)
  • (6)
  • (94)
  • (5)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (5)
  • (67)
  • (46)
  • (84,648)
  • (3,624)
  • (3)
  • (3)
  • (37)
  • (1)
  • (1)
  • (9)
  • (3)
  • (10)
  • (26)
  • (3)
  • (3)
  • (1)
  • (1)
  • (3)
  • (22)
  • (103)
  • (1)

special programs

  • (15)
  • (21)
  • (13)
  • (13)
  • (62)

Target Species

  • (15)
  • (43)
  • (76)
  • (5)
  • (169)
  • (16)
  • (190)
Show all

Quantity

  • (1)
  • (714)
  • (172)
  • (257)
  • (219)
  • (38)
  • (209)
Show all

Conjugate

  • (2,201)
  • (370)
  • (3)
  • (22)
  • (2,003)
  • (2,203)
  • (2,229)
Show all

Applications

  • (23)
  • (12)
  • (28)
  • (116)
  • (16)
  • (193)
  • (84)
Show all

Classification

  • (60,741)
  • (10)
  • (26,713)

Host Species

  • (102)
  • (130)
  • (1,483)
  • (55)
  • (1,892)
  • (43,907)
  • (34,874)
Show all

Isotype

  • (2)
  • (1)
  • (4)
  • (1)
  • (1)
  • (10)
  • (1)
Show all

Regulatory Status

  • (48)
  • (83,597)

Form

  • (42)
  • (78)
  • (6)
  • (1)
  • (71)
  • (3)
  • (1)
Show all

For Use With (Application)

  • (1)
  • (214)
  • (33)
  • (2)
  • (2)
  • (4)
  • (1,451)
Show all

Search results for "cell biology"

1 – 15 of 85,982 results
1

Fisher BioReagents™ Proteinase K (Tritirachium album/Molecular Biology)

EDGE
Content And Storage -20°C
Form Solid
Product Type Proteinase K
Color White
For Use With (Application) Isolation of DNA and RNA from cell and tissue preparations, inactivating many Enzymes, including Endogenous Nucleases
Source Tritirachium album
4

2-Mercaptoethanol Cell Culture MP Biomedicals

CAS: 60-24-2 Molecular Formula: C2H6OS Molecular Weight (g/mol): 78.13 MDL Number: MFCD00004890 InChI Key: DGVVWUTYPXICAM-UHFFFAOYSA-N Synonym: 2-mercaptoethanol,mercaptoethanol,thioglycol,beta-mercaptoethanol,ethanol, 2-mercapto,2-thioethanol,2-hydroxy-1-ethanethiol,thioethylene glycol,2-hydroxyethanethiol,2-hydroxyethyl mercaptan PubChem CID: 1567 ChEBI: CHEBI:41218 IUPAC Name: 2-sulfanylethan-1-ol SMILES: OCCS

PubChem CID 1567
CAS 60-24-2
Molecular Weight (g/mol) 78.13
ChEBI CHEBI:41218
MDL Number MFCD00004890
SMILES OCCS
Synonym 2-mercaptoethanol,mercaptoethanol,thioglycol,beta-mercaptoethanol,ethanol, 2-mercapto,2-thioethanol,2-hydroxy-1-ethanethiol,thioethylene glycol,2-hydroxyethanethiol,2-hydroxyethyl mercaptan
IUPAC Name 2-sulfanylethan-1-ol
InChI Key DGVVWUTYPXICAM-UHFFFAOYSA-N
Molecular Formula C2H6OS
6

D-myo-Inositol, 99.2%, Cell culture reagent, For HPLC analysis, MP Biomedicals™

CAS: 87-89-8 Molecular Formula: C6H12O6 Molecular Weight (g/mol): 180.156 MDL Number: MFCD00077932 InChI Key: CDAISMWEOUEBRE-UHFFFAOYSA-N Synonym: scyllo-inositol,myo-inositol,inositol,muco-inositol,epi-inositol,i-inositol,meso-inositol,allo-inositol,1d-chiro-inositol,myoinositol PubChem CID: 892 ChEBI: CHEBI:24848 IUPAC Name: cyclohexane-1,2,3,4,5,6-hexol SMILES: C1(C(C(C(C(C1O)O)O)O)O)O

PubChem CID 892
CAS 87-89-8
Molecular Weight (g/mol) 180.156
ChEBI CHEBI:24848
MDL Number MFCD00077932
SMILES C1(C(C(C(C(C1O)O)O)O)O)O
Synonym scyllo-inositol,myo-inositol,inositol,muco-inositol,epi-inositol,i-inositol,meso-inositol,allo-inositol,1d-chiro-inositol,myoinositol
IUPAC Name cyclohexane-1,2,3,4,5,6-hexol
InChI Key CDAISMWEOUEBRE-UHFFFAOYSA-N
Molecular Formula C6H12O6
7
Promotions Available

Carl Zeiss™ Primovert Microscope with Binocular Tube

Compact inverted routine microscope that combines efficiency and optical performance. This inverted microscope is configured for transmitted light brightfield and phase contrast. This system is ideal for cell culture, routine work and quick & easy imaging.

9

Cytiva™ Whatman™ Nuclepore™ Polycarbonate Track-Etched (PCTE) Cell Culture Membrane Filters (PVP-Free)

Made from high-quality polycarbonate track-etched (PCTE) film, Nuclepore™ PCTE Membranes offer highly defined pore size cutoffs for particle deformity measurement and capture of small particles. With high flow rates and excellent chemical/thermal resistance, these membranes are supplied PVP-free.

10

Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P23946
Research Discipline Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Antigen Chymase/CMA1/Mast Cell Chymase
Gene Symbols CMA1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gene ID (Entrez) 1215
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
11

Tocris Bioscience™ Cell counting kit-8
GREENER_CHOICE

Cell viability and proliferation assay test solution

12

Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Content And Storage Store at 4C. Do not freeze.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Form Purified
Isotype IgG1
Gene Accession No. P23946
Research Discipline Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Antigen Chymase/CMA1/Mast Cell Chymase
Gene Symbols CMA1
Regulatory Status RUO
Purification Method Protein A or G purified
Gene Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gene ID (Entrez) 1215
Immunogen BALB/C mice were injected with a purified human skin chymase.
Classification Monoclonal
Primary or Secondary Primary
Test Specificity This reacts with mast cells distributed in skin, synovium, lung and heart.
Clone CC1
13

Tocris Bioscience™ DMSO, Cell Cryopreserve Grade
GREENER_CHOICE

Intracellular cryoprotective agent

14

Novus Biologicals™ Recombinant Human Host Cell Factor 1/HCFC1 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias CFFC1 factor, HCF, HCF1HFC1, HCF-1VP16 accessory protein, host cell factor C1 (VP16-accessory protein), MGC70925, VCAFhost cell factor 1
Molecular Weight (g/mol) 35.31 kDa
Gene ID (Entrez) 3054
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol HCFC1
Research Category Cell Biology, Cell Cycle and Replication, Endocrinology
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein Host Cell Factor 1/HCFC1