Primary Antibodies
Filtered Search Results
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | P23946 |
| Research Discipline | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Symbols | CMA1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C. Do not freeze. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P23946 |
| Research Discipline | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Symbols | CMA1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Immunogen | BALB/C mice were injected with a purified human skin chymase. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | This reacts with mast cells distributed in skin, synovium, lung and heart. |
| Clone | CC1 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry |
| Form | Purified |
| Isotype | IgG1 κ |
| Research Discipline | Cardiovascular Biology |
| Concentration | 1 mg/mL |
| Antigen | Mast Cell Marker |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Immunohistochemistry 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MCG35 |
L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™
Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.
| Antigen | L1 Cell Adhesion Molecule Ab-1 |
|---|---|
| Regulatory Status | RUO |
| Target Species | Human |
| Host Species | Mouse |
| Applications | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
| Immunogen | Homogenous suspension of 16 week human fetal brain |
| Classification | Monoclonal |
| Isotype | IgG2a κ |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | UJ127 |
Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™
Rat Monoclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rat |
| Conjugate | Alexa Fluor 488 |
| Applications | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation |
| Form | Purified |
| Isotype | IgG2a κ |
| Research Discipline | Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers |
| Antigen | Panendothelial Cell Antigen |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Gene Alias | FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein |
| Gene ID (Entrez) | 84094 |
| Formulation | 50mM Sodium Borate |
| Immunogen | Mouse lymph node stromal cells. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MECA-32 |
CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™
Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.
| Antigen | CD31 (Endothelial Cell Marker) |
|---|---|
| Regulatory Status | RUO |
| Purification Method | Tonsil |
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin) |
| Immunogen | Synthetic peptide corresponding to C-terminus of mouse CD31 protein |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody
Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.
| Antigen | Desmin (Muscle Cell Marker) Ab-1 |
|---|---|
| Regulatory Status | IVD |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence,Immunohistochemistry (Paraffin) |
| Immunogen | Desmin from human muscle |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Muscle Biology |
| Clone | D33 |
Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™
Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.
| Antigen | Renal Cell Carcinoma Marker (gp200) Ab-1 |
|---|---|
| Regulatory Status | IVD |
| Host Species | Mouse |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Immunogen | Microsomal fraction of human renal cortical tissue homogenate |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | PN-15 |
Epredia™ Lab Vision™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody
Obtain accurate, reproducible results in immunohistochemistry experiments with Epredia™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody.
| Antigen | CD79a/mb-1 (B-Cell Marker) |
|---|---|
| Regulatory Status | IVD |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin) |
| Immunogen | Synthetic peptide derived from N-terminal region of human CD79a protein |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | SP18 |
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2O4P8 |
Zebrafish Basolateral Pole of Cells Antibody (FIS 2H9/1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Zebrafish |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Developmental Biology, Epitope Tags |
| Concentration | 1 mg/mL |
| Antigen | Zebrafish Basolateral Pole of Cells |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:100 - 1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Lysate of zebrafish intestine |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FIS 2H9/1 |
Zebrafish Gut Absorptive Cell Epitopes Antibody (FIS 4B7/1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Zebrafish |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunofluorescence,Immunoprecipitation |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Concentration | 1 mg/mL |
| Antigen | Zebrafish Gut Absorptive Cell Epitopes |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500, Immunoprecipitation 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Zebrafish intestine |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FIS 4B7/1 |
Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 2F11/2) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Zebrafish |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunofluorescence,Immunoprecipitation |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Concentration | 1 mg/mL |
| Antigen | Zebrafish Gut Secretory Cell Epitopes |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:500, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500, Immunoprecipitation 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Lysate of zebrafish intestine |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FIS 2F11/2 |
Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 6G5/1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Zebrafish |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Concentration | 0.9 mg/mL |
| Antigen | Zebrafish Gut Secretory Cell Epitopes |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:200, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Lysate of zebrafish intestine |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FIS 6G5/1 |