Recombinant Proteins
- (2)
- (6)
- (6)
- (6)
- (6)
- (11)
- (1,857)
- (92)
- (1)
- (1)
- (2)
- (50)
- (7)
- (2)
- (15)
- (1)
- (457)
- (8)
- (28,102)
- (1)
- (8)
- (3)
- (15)
- (1)
- (3)
- (13)
- (1)
- (7)
- (1)
- (3)
- (2)
- (3)
- (4)
- (3)
- (2)
- (4)
- (3)
- (3)
- (4)
- (4)
- (2)
- (2)
- (2)
- (1)
- (4)
- (1)
- (6,728)
- (197)
- (22)
- (19)
- (17)
- (8)
- (4)
- (1)
- (3)
- (2)
- (6)
- (218)
- (4)
- (940)
- (18)
- (2)
- (2)
- (14)
- (53)
- (2)
- (2)
- (2)
- (1)
- (42)
- (7)
- (44)
- (31)
- (2)
- (58)
- (150)
- (177)
- (13)
- (12)
- (3)
- (8)
- (4)
- (156)
- (3)
- (3)
- (3)
- (2)
- (2)
- (14)
- (30,024)
- (4)
- (4,493)
- (2)
- (4)
- (2,848)
- (1)
- (28,533)
- (65)
- (4,706)
- (24)
- (1)
- (8)
- (2)
- (7)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (248)
- (14)
- (1)
- (1)
- (28)
- (2)
- (48,659)
- (22)
- (2)
- (4)
- (32)
- (700)
- (4)
- (3)
- (110)
- (47)
- (1,566)
- (3)
- (7)
- (3)
- (19,645)
- (8)
- (31)
- (19)
- (68)
- (15)
- (3)
- (77)
- (149)
- (97)
- (10)
- (3)
- (132)
- (4)
- (2)
- (11)
- (1)
- (1)
- (5)
- (2)
- (4)
- (4,209)
- (4)
- (3)
- (47,863)
- (1)
- (62)
- (4)
- (5)
- (6)
- (1)
- (8,200)
- (4)
- (4)
- (1)
- (2)
- (5)
- (1)
- (48,333)
- (6)
- (38,176)
- (18)
- (3)
- (26,393)
- (1,067)
- (3,600)
- (144)
- (3,391)
- (2)
- (54)
- (55)
- (4)
- (4)
- (1)
- (373)
- (1)
- (2)
- (1)
- (1)
- (98)
- (2)
- (2)
- (2)
- (2)
- (1)
- (12)
- (677)
- (1)
- (46)
- (13,083)
- (2)
- (2)
Filtered Search Results
R&D Systems™ Recombinant Human IL-2 Biotinylated Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human LIF, Biotinylated Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Purity or Quality Grade | >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining |
|---|---|
| Conjugate | Biotin |
| Molecular Weight (g/mol) | 20 kDa |
| Quantity | 25 μg |
| Endotoxin Concentration | <0.10 EU per 1μg of the protein by the LAL method |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived human LIF protein Pro24-Phe202 |
| Accession Number | P15018 |
| Regulatory Status | RUO |
| Gene Alias | CDF, D factor, DIA, differentiation inhibitory activity, differentiation stimulating factor, Differentiation-stimulating factor, Emfilermin, HILDA, HILDAcholinergic differentiation factor, leukemia inhibitory factor, leukemia inhibitory factor (cholinergic differentiation factor), Melanoma-derived LPL inhibitor, MLPLI |
| Product Type | Recombinant protein |
| Biological Activity | 0.02 to 0.12ng/mL |
| Gene ID (Entrez) | 3976 |
| Structural Form | Biotinylated protein via amines |
| Species | Human |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human TNF-alpha, Biotinylated Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
R&D Systems™ Biotinylated Recombinant Human IL-7 Protein
Carrier Free Recombinant Protein
R&D Systems™ Biotinylated Recombinant Human VEGF 165 Protein
Biotinylated via amines
R&D Systems™ Recombinant Human IL-2 Biotinylated Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Buffer | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining. |
| Conjugate | Biotin |
| Molecular Weight (g/mol) | M.W. (Observed): 59-67 kDa, under reducing conditions; M.W. (theoretical): 37 kDa |
| Endotoxin Concentration | <0.10 EU / 1 μg of the protein by the LAL method. |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution. |
| For Use With (Application) | Bioactivity |
| Protein | CD155/PVR |
| Source | Human embryonic kidney cell, HEK293-derived human CD155/PVR protein Human CD155/PVR (Gly27-Asn343) (N-terminus) Accession # NP_006496.4 HHHHHH Avi-tag (C-terminus) |
| Accession Number | NP_006496.4 |
| Gene ID (Entrez) | 5817 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Reconstitution | Reconstitute at 500 μg/mL in PBS. |
| Species | Human |
R&D Systems™ Recombinant Human B7-H7 Fc Biotinylated Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human CX3CL1/Fractalkine His Avi-tag Protein
Biotinylated
R&D Systems™ Recombinant Human IL-17A/F Heterodimer Biotinylated Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human IL-17A/F Heterodimer Biotin Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
enQuireBio™ Recombinant Human C3c Protein
A cDNA sequence encoding the C3c was constructed and used to recombinantly synthesize the protein.
| Buffer | The Human Complement C3c was lyophilized in a sodium phosphate buffer, pH 7.2, containing 0.15M NaCl. |
|---|---|
| Regulatory Status | Research Use Only |
| Purity or Quality Grade | Greater than 96.0%. |
| Product Type | Recombinant Protein |
| Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
| Sequence | C3c Beta chain (23-667)SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKC3c alpha chain fragment 1 (749-954)SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGRC3c alpha chain fragment 2 (1321-1663)SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN |
| Cross Reactivity | Human |
| Protein Tag | Untagged |
| Species | Human |
| Name | C3c Protein |
R&D Systems™ Recombinant Human Endoglin/CD105 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | 90%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 61 kDa |
| Gene ID (Entrez) | 2022 |
| Quantity | 25 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | Mouse myeloma cell line,NS0-derived human Endoglin/CD105 protein Glu26-Gly586 |
| Recombinant | Recombinant |
| Name | Endoglin/CD105 |