accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Recombinant 
  • (13)
Species 
  • (6)
  • (7)
For Use With (Application) 
  • (1)
  • (7)
  • (3)
  • (1)
  • (6)
  • (1)
  • (6)
  • (6)
Conjugate 
  • (9)
Form 
  • (7)
  • (2)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (4)
  • (7)
  • (1)
  • (7)

Recombinant

  • (13)

Species

  • (6)
  • (7)

For Use With (Application)

  • (1)
  • (7)
  • (3)
  • (1)
  • (6)
  • (1)
  • (6)
  • (6)

Conjugate

  • (9)

Form

  • (7)
  • (2)
Keyword Search:
1 – 14 of 14 results
1

ACROBiosystems Human CD209 / DC-SIGN Protein, His Tag

Buffer PBS, pH7.4
Purity or Quality Grade >90% as determined by SDS-PAGE
Conjugate Unconjugated
Form Powder
Common Name CD209
Molecular Weight (g/mol) 41.3 kDa
Endotoxin Level Less than 1.0 EU / μg by the LAL method.
Storage Requirements -20°C
Expression System HEK293
Source Human CD209, His Tag (CD9-H5246) is expressed from human 293 cells (HEK293). It contains AA Gln 59 - Ala 404 (Accession # Q9NN x 6-1).
Protein Subtype Bio-Markers and CD Antigens
Accession Number NP_066978.1
Gene Alias DC-SIGN,CD209,DC-SIGN1,CLEC4L
Immunogen Gln 59 - Ala 404
Protein Tag His Tag
Species Human
2
Promotions Available

R&D Systems™ Recombinant Human DC-SIGN/CD209 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

3
Promotions Available

R&D Systems™ Recombinant Mouse DC-SIGN/CD209 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

4

AcroBiosystems Biotinylated Human CD209 / DC-SIGN Protein, AvitagTM,His Tag

Recombinant Protein

Characterization CD209 Structure This protein carries an Avi tag (AvitagTM) at the N-terminus, followed by a polyhistidine tag. The protein has a calculated MW of 43.0 kDa. The protein migrates as 47-50 kDa when calibrated against under reducing (R) condition (SDS-PAGE) due to glycosylation.
Accession Number Uniprot
Content And Storage -20°C to -70°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution. For long term storage, the product should be stored at lyophilized state at -20°C or lower.
Purity or Quality Grade 0.95
Format Powder
Biological Activity Immobilized SARS-CoV-2 Spike S1, His Tag (Cat. No. S1N-C52Ht) at 1 μg/mL (100 μL/well) can bind Biotinylated Human CD209 Protein, Avitag,His Tag (Cat. No. CD9-H82Q3) with a linear range of 0.07-0.313 μg/mL (QC tested).
Formulation Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4 with trehalose as protectant. Contact us for customized product form or formulation.
Endotoxin Level Less than 1.0 EU per μg by the LAL method / rFC method.
Quality Control Testing Less than 1.0 EU per μg by the LAL method / rFC method.
Shelf Life -20°C to -70°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution. For long term storage, the product should be stored at lyophilized state at -20°C or lower.
Species Human
Source Biotinylated Human CD209 Protein, Avitag,His Tag (CD9-H82Q3) is expressed from human 293 cells (HEK293). It contains AA Gln 59 - Ala 404 (Accession # ). Predicted N-terminus: Gly Request for sequence
7
Promotions Available

R&D Systems™ Recombinant Mouse SIGNR7/CD209g Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

8
Promotions Available

R&D Systems™ Recombinant Mouse SIGNR1/CD209b Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

9

Abnova™ Human CD209 Partial ORF (NP_066978.1, 271 a.a. - 380 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name CD209
Molecular Weight (g/mol) 37.84kDa
Gene Symbol CD209
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name CD209 (Human) Recombinant Protein (Q01)
Accession Number NP_066978.1
Regulatory Status RUO
Gene Alias CDSIGN/CLEC4L/DC-SIGN/DC-SIGN1/MGC129965
Gene ID (Entrez) 30835
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKS
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
11

Abnova™ Human CD209 Full-length ORF (NP_066978.1, 1 a.a. - 404 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name CD209
Molecular Weight (g/mol) 72.2kDa
Gene Symbol CD209
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name CD209 (Human) Recombinant Protein (P01)
Accession Number NP_066978.1
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias CDSIGN/CLEC4L/DC-SIGN/DC-SIGN1/MGC129965
Gene ID (Entrez) 30835
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
12
Promotions Available

R&D Systems™ Recombinant Human DC-SIGNR/CD299 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

13
Promotions Available

R&D Systems™ Recombinant Human BTN2A1/Butyrophilin 2A1 Protein

Learn More About B7-related Butryophilins as Immune Modulators View Webinar

14

Abnova™ Human CLEC4M Partial ORF (NP_055072, 285 a.a. - 394 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name CLEC4M
Molecular Weight (g/mol) 37.84kDa
Gene Symbol CLEC4M
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name CLEC4M (Human) Recombinant Protein (Q01)
Accession Number NP_055072
Regulatory Status RUO
Gene Alias CD209L/CD299/DC-SIGN2/DC-SIGNR/DCSIGNR/HP10347/L-SIGN/LSIGN/MGC129964/MGC47866
Gene ID (Entrez) 10332
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant