accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application) 
  • (2)
  • (2)
  • (11)
  • (9)
  • (2)
  • (11)
  • (11)
Species 
  • (3)
Form 
  • (2)
Recombinant 
  • (2)
Keyword Search: Clocks Clear all selections

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

Clocks

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (3)
  • (11)

For Use With (Application)

  • (2)
  • (2)
  • (11)
  • (9)
  • (2)
  • (11)
  • (11)

Species

  • (3)

Form

  • (2)

Recombinant

  • (2)
1 – 9 of 9 results
1

Novus Biologicals™ Recombinant Human CLOCK GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein
Molecular Weight (g/mol) MolecularWeight-theroretical: 36.74 kDa
Gene ID (Entrez) 9575
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol CLOCK
Research Category Cancer, Circadian Rhythm, Hypoxia, Neuroscience, Transcription Factors and Regulators, Vision
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein CLOCK
2

Abnova™ Human CLOCK Partial ORF (NP_004889, 497 a.a. - 596 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name CLOCK
Molecular Weight (g/mol) 36.74kDa
Gene Symbol CLOCK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name CLOCK (Human) Recombinant Protein (Q01)
Accession Number NP_004889
Regulatory Status RUO
Gene Alias KAT13D/KIAA0334/bHLHe8
Gene ID (Entrez) 9575
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen PVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPIN
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
5

Novus Biologicals™ Recombinant Human PER2 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias Circadian clock protein PERIOD 2, FASPS, hPER2, KIAA0347period 2, period (Drosophila) homolog 2, period circadian protein 2, period circadian protein homolog 2, period homolog 2 (Drosophila)
Molecular Weight (g/mol) 36.74 kDa
Gene ID (Entrez) 8864
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol PER2
Research Category Cancer, Circadian Rhythm, Hypoxia, Neuroscience, Vision
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein PER2
6

Novus Biologicals™ Recombinant Human PER3 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila)
Molecular Weight (g/mol) 69.5 kDa
Gene ID (Entrez) 8863
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol PER3
Research Category Cardiovascular Biology, Endocrinology
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,PAGE,Protein Array,Immunoaffinity Purification
Protein PER3
7

Novus Biologicals™ Recombinant Human PER3 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila)
Molecular Weight (g/mol) 36.41 kDa
Gene ID (Entrez) 8863
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol PER3
Research Category Cardiovascular Biology, Endocrinology
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein PER3
8

Abnova™ CLOCK (Human) Recombinant Protein

Human CLOCK full-length ORF (ABZ92219.1, 1 a.a. - 846 a.a.) recombinant protein with GST tag at N-terminal.