Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
952,460
results
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | P16104 |
| Research Discipline | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Concentration | 1 mg/mL |
| Antigen | Histone H2AX (p Ser139) |
| Gene Symbols | H2AFX |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Molecular Weight of Antigen | 15 kDa |
| Gene Alias | H2A.X, H2A/X, H2AFX |
| Gene ID (Entrez) | 3014 |
| Immunogen | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
| Clone | 3F2 |
| Purity or Quality Grade | >97% pure by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Molecular Weight (g/mol) | 33.4 kDa |
| Gene ID (Entrez) | 3919448 |
| Formulation | Lyophilized from additive free solution. |
| Research Category | Epitope Tags |
| Reconstitution | Dissolve in distilled water or saline. |
| Endotoxin Concentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity,HPLC |
| Protein | Protein A |
Novus Biologicals™ DHEA ELISA Kit (Colorimetric)
Highly purified and high bioactivity. Generating reliable and reproducible results.
Coagulation Factor III/Tissue Factor Antibody (SN20-16), Novus Biologicals™
Rabbit Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer |
| Concentration | 1 mg/mL |
| Antigen | CoagulationFactorIII/TissueFactor |
| Gene Symbols | F3 |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:100-1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:100-1:500 |
| Gene Alias | CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor |
| Gene ID (Entrez) | 2152 |
| Formulation | TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide |
| Immunogen | Synthetic peptide within human Coagulation Factor III/Tissue Factor aa 30-70. (SwissProt: P13726 Human; SwissProt: P20352 Mouse; SwissProt: P42533 Rat) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SN20-16 |
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q14674 |
| Research Discipline | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Concentration | 0.9 mg/mL |
| Antigen | Separase |
| Gene Symbols | ESPL1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:500 |
| Gene Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gene ID (Entrez) | 9700 |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | XJ11-1B12 |
Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1), Alexa Fluor™ 647, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Signal Transduction, Vision |
| Antigen | USH1C |
| Gene Symbols | USH1C |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias | AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein |
| Gene ID (Entrez) | 10083 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
MHC class II (I-A/I-E) Antibody (M5/114.15.2), Alexa Fluor™ 750, Novus Biologicals™
Rat Monoclonal Antibody