missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ XRCC2 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-56170PEP
Additional Details : Weight : 0.00970kg
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XRCC2. Source: E.coli Amino Acid Sequence: AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC The XRCC2 Recombinant Protein Antigen is derived from E. coli. The XRCC2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 7516 | |
| XRCC2 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| DKFZp781P0919, DNA repair protein XRCC2, X-ray repair complementing defective repair in Chinese hamster cells 2, X-ray repair cross-complementing protein 2, X-ray repair, complementing defective, repair in Chinese hamster | |
| Unlabeled | |
| 100μL | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| XRCC2 | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52847. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
For Research Use Only.