Primary Antibodies
Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
103
results
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_079968 |
Antigen | UFM1 Activating Enzyme/UBA5 |
Gene Symbols | UBA5 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 44 kDa |
Gene Alias | FLJ17281, FLJ23251UBA5, ThiFP1, UBE1DC1ubiquitin-activating enzyme E1 homolog, ubiquitin-like modifier activating enzyme 5, ubiquitin-like modifier-activating enzyme 5, UFM1-activating enzyme |
Gene ID (Entrez) | 79876 |
Immunogen | The immunogen for this antibody is Uba5 - N-terminal region. Peptide sequence LLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYN. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Antigen | UFM1 Activating Enzyme/UBA5 |
---|---|
Gene Symbols | UBA5 |
Regulatory Status | RUO |
Gene Alias | FLJ17281, FLJ23251UBA5, ThiFP1, UBE1DC1ubiquitin-activating enzyme E1 homolog, ubiquitin-like modifier activating enzyme 5, ubiquitin-like modifier-activating enzyme 5, UFM1-activating enzyme |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 79876 |
Immunogen | Synthetic peptides corresponding to UBA5(ubiquitin-like modifier activating enzyme 5) The peptide sequence was selected from the middle region of UBA5. Peptide sequence VLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACF. |
Classification | Polyclonal |
Isotype | IgG |
Gene Accession No. | Q9GZZ9 |
Primary or Secondary | Primary |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Mouse |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q8R0F3 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 1/SUMF1 |
Gene Symbols | SUMF1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.1 ug/mL |
Gene Alias | AAPA3037, EC 1.8.99.-, FGE1, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037 |
Gene ID (Entrez) | 285362 |
Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Sulfatase Modifying Factor 1/SUMF1 Ser32-Asp372 Accession # Q8R0F3 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects mouse Sulfatase Modifying Factor 1/SUMF1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 50% cross-reactivity with recombinant human SUMF1 is observed and 10% cross-reactivity with recombinant mouse SUMF2 is observed. |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Isotype | IgG |
Gene Accession No. | Q8NBJ7 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Immunogen | Mouse myeloma cell line NS0-derived recombinant human Sulfatase Modifying Factor 2/SUMF2 Gln26-Leu301 Accession # Q8NBJ7 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 45% cross-reactivity with recombinant mouse SUMF2 is observed and less than 1% cross-reactivity with recombinant human SUMF1 is observed. |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Mouse |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Isotype | IgG |
Gene Accession No. | Q8BPG6 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Sulfatase Modifying Factor 2/SUMF2 Gln34-Leu308 Accession # Q8BPG6 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects mouse Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 10% cross-reactivity with recombinant human (rh) SUMF2 and less than 5% cross-reactivity with rhSUMF1 is observed. |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Mouse |
Host Species | Rat |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG2a |
Gene Accession No. | Q8BPG6 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Western Blot 1 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Sulfatase Modifying Factor 2/SUMF2 Gln34-Leu308 Accession # Q8BPG6 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects mouse Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. In Western blots, no cross-reactivity with recombinant human SUMF2 or recombinant mouse SUMF1 is observed. |
Clone | 382407 |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Form | Purified |
Isotype | IgG2b |
Gene Accession No. | Q8NBJ7 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Western Blot 1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | Mouse myeloma cell line NS0-derived recombinant human Sulfatase Modifying Factor 2/SUMF2 Gln26-Leu301 Accession # Q8NBJ7 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. No cross-reactivity with recombinant human SUMF1 or recombinant mouse SUMF2 is observed. |
Clone | 330312 |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human,Mouse |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Form | Purified |
Isotype | IgG2b |
Gene Accession No. | Q8NBK3.3 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 1/SUMF1 |
Gene Symbols | SUMF1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Western Blot 1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | AAPA3037, EC 1.8.99.-, FGE1, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037 |
Gene ID (Entrez) | 285362 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | Mouse myeloma cell line NS0-derived recombinant human Sulfatase Modifying Factor 1/SUMF1 isoform 1 Ser34-Asp374 (Ser63Asn) Accession # Q8NBK3.3 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects recombinant human or mouse Sulfatase Modifying Factor 1/SUMF1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, no cross-reactivity with recombinant human SUMF2 or recombinant mouse SUMF2 is observed. |
Clone | 329005 |
Sulfatase Modifying Factor 1/SUMF1 Goat anti-Mouse, Polyclonal, R&D Systems™
Goat Polyclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sulfatase Modifying Factor 2/SUMF2 Goat anti-Human, Polyclonal, R&D Systems™
Goat Polyclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sulfatase Modifying Factor 2/SUMF2 Goat anti-Mouse, Polyclonal, R&D Systems™
Goat Polyclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sulfatase Modifying Factor 2/SUMF2 Mouse anti-Human, Clone: 330312, R&D Systems™
Mouse Monoclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sulfatase Modifying Factor 2/SUMF2 Rat anti-Mouse, Clone: 382407, R&D Systems™
Rat Monoclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More