missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ TUBB4B (Human) Recombinant Protein (P02)

Name: Abnova&trade; TUBB4B (Human) Recombinant Protein (P02)
Brand: Abnova&trade;
SKU: 16124982
Price: 335.00 EUR

Human TUBB4B full-length ORF recombinant protein with GST-tag at N-terminal

Brand: Abnova™ H00010383-P02.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16124982

335.00€ / 10µg

Quantity

Estimated Shipment: 31-05-2024
to see stock.

Add to basket

Description

Theoretical MW (kDa): 74.47
Preparation method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 fast flow
Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH01911
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	74.47
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA
Gene Alias	RP13-122B23.2/Beta2/TUBB2/TUBB2C
Gene Symbol	TUBB4B
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	10383
Name	TUBB4B (Human) Recombinant Protein (P02)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	TUBB4B
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Abnova™ TUBB4B (Human) Recombinant Protein (P02)

Description

Specifications

Product Suggestions

Documents

Special Offers