missing translation for 'onlineSavingsMsg'
Learn More

NDRG3 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Name: NDRG3 Rabbit anti-Human, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16163980
Price: 490.00 EUR

Rabbit polyclonal antibody raised against recombinant NDRG3.

Brand: Abnova PAB21027.100uL

Additional Details : Weight : 0.02000kg

Product Code. 16163980

Quantity

Estimated Shipment: 14-05-2024
to see stock.

Add to basket

Description

Sequence: CAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGD

Specifications

Antigen	NDRG3
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against recombinant NDRG3.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Alias	FLJ13556
Host Species	Rabbit
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Gene ID (Entrez)	57446
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Applications	Immunohistochemistry (PFA fixed), Western Blot
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Gene	NDRG3
Gene Symbols	NDRG3
Immunogen	Recombinant protein corresponding to amino acids of human NDRG3.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Product Suggestions

For Research Use Only

Description