missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RAB8A (Human) Recombinant Protein

Name: Abnova&trade; RAB8A (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16161175
Price: 508.00 EUR

Human RAB8A full-length ORF ( AAH02977, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004218-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16161175

Quantity

Estimated Shipment: 06-06-2024
to see stock.

Add to basket

Description

Sequence: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL

Specifications

Accession Number	AAH02977
Name	RAB8A, member RAS oncogene family
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	RAB8A
Protein Tag	GST

Gene ID (Entrez)	4218
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	MEL, RAB8
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description