missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RAB8A (Human) Recombinant Protein

Human RAB8A full-length ORF ( AAH02977, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004218-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161175

  • 545.00€ / 25µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Specifications

Specifications

AAH02977
RAB8A, member RAS oncogene family
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAB8A
GST
4218
Wheat germ expression system
25 μg
MEL, RAB8
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers