missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18237200

Novus Biologicals™ PTP mu/PTPRM Recombinant Protein Antigen

Product Code. 18237200 Shop All Bio Techne Products
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 18237200

Brand: Novus Biologicals™ NBP254929PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTP mu/PTPRM. Source: E.coli Amino Acid Sequence: STRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYEVST The PTP mu/PTPRM Recombinant Protein Antigen is derived from E. coli. The PTP mu/PTPRM Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 5797
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name PTP mu/PTPRM Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias EC 3.1.3.48, hR-PTPu, MGC166994, protein tyrosine phosphatase mu, protein tyrosine phosphatase, receptor type, M, protein tyrosine phosphatase, receptor type, mu polypeptide, Protein-tyrosine phosphatase mu, PTPRL1R-PTP-MU, receptor-type tyrosine-protein
Gene Symbol PTPRM
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51043. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

For research use only.

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis