missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPP1CA (Human) Recombinant Protein

Human PPP1CA full-length ORF ( AAH08010.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Accession Number	AAH08010.1
Gene ID (Entrez)	5499
Name	protein phosphatase 1, catalytic subunit, alpha isoform
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16113165 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00005499-P01.10UG	10 μg	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 05-06-2024 Log in to see stock.	Add to basket

16123165 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00005499-P01.25UG	25 μg	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 05-06-2024 Log in to see stock.	Add to basket

Description

Sequence: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Specifications

Accession Number	AAH08010.1
Name	protein phosphatase 1, catalytic subunit, alpha isoform
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	MGC15877, MGC1674, PP-1A, PPP1A
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	5499
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PPP1CA
Protein Tag	GST

Description