missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PCGF4 (Human) Recombinant Protein

Human PCGF4 full-length ORF ( AAH11652, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000648-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122271

  • 545.00€ / 25µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGSSATSSG
Specifications

Specifications

AAH11652
BMI1 polycomb ring finger oncogene
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BMI1
GST
648
Wheat germ expression system
25 μg
MGC12685, PCGF4, RNF51
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers