missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PCGF4 (Human) Recombinant Protein

Human PCGF4 full-length ORF ( AAH11652, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Accession Number	AAH11652
Gene ID (Entrez)	648
Name	BMI1 polycomb ring finger oncogene
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16112271 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000648-P01.10UG	10 μg	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 05-06-2024 Log in to see stock.	Add to basket

16122271 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000648-P01.25UG	25 μg	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 05-06-2024 Log in to see stock.	Add to basket

Description

Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGSSATSSG

Specifications

Accession Number	AAH11652
Name	BMI1 polycomb ring finger oncogene
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	MGC12685, PCGF4, RNF51
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	648
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	BMI1
Protein Tag	GST

Description