missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PADI4 (Human) Recombinant Protein
Human PADI4 partial ORF ( NP_004247, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00023569-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL
Specifications
| NP_004247 | |
| peptidyl arginine deiminase, type IV | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PADI4 | |
| GST |
| 23569 | |
| Wheat germ expression system | |
| 10 μg | |
| PAD, PAD4, PADI5, PDI4, PDI5 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |