missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PADI4 (Human) Recombinant Protein

Human PADI4 partial ORF ( NP_004247, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00023569-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16124856

  • 359.00€ / 10µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

  • Sequence: AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL
Specifications

Specifications

NP_004247
peptidyl arginine deiminase, type IV
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PADI4
GST
23569
Wheat germ expression system
10 μg
PAD, PAD4, PADI5, PDI4, PDI5
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers