missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MAP1LC3B Recombinant Protein

335.00€ - 508.00€

Accession Number	AAH18634
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	81631
Molecular Weight (g/mol)	39.49

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16155213 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00081631-P01.10UG	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

16165213 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00081631-P01.25UG	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH18634
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	39.49
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	MAP1LC3B
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	81631
Name	MAP1LC3B (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Gene Alias	LC3B/MAP1A/1BLC3
Gene Symbol	MAP1LC3B
Species	Wheat Germ (in vitro)
Protein Tag	GST

Description