missing translation for 'onlineSavingsMsg'
Learn More

Print

MAML3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

459.00€

Specifications

Antigen	MAML3
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18392135 View Documents missing translation for 'viewProductCertificates'	Bio-Techne NBP3-09240-100UL	100 μg	459.00€ 100µL	Estimated Shipment: 10-01-2025 Log in to see stock.	Add to basket

Description

Description

MAML3 Polyclonal specifically detects MAML3 in Human samples. It is validated for Western Blot.

Specifications

Specifications

Antigen	MAML3
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Neuroscience
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	55534
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	CAG/CTG 3, ERDA3, MAM-2, mam-3, mastermind-like 3 (Drosophila), mastermind-like protein 3, polyglutamine rich, trinucleotide repeat containing 3
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MAML3 (NP_061187). Peptide sequence YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG
Purification Method	Affinity purified

Back to Top