missing translation for 'onlineSavingsMsg'
Learn More

MAML3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09240-100UL

Product Code. 18392135

Quantity

Estimated Shipment: 10-01-2025
to see stock.

Add to basket

This item is not returnable. View return policy

Description

MAML3 Polyclonal specifically detects MAML3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	MAML3
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	CAG/CTG 3, ERDA3, MAM-2, mam-3, mastermind-like 3 (Drosophila), mastermind-like protein 3, polyglutamine rich, trinucleotide repeat containing 3
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MAML3 (NP_061187). Peptide sequence YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG
Quantity	100 μg
Research Discipline	Neuroscience
Gene ID (Entrez)	55534
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description