missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IL7 (Human) Recombinant Protein

Human IL7 full-length ORF ( AAH47698, 26 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00003574-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16156791

  • 359.00€ / 10µg

Estimated Shipment: 26-07-2022
to see stock.
Add to basket

Description

Description

  • Sequence: DCDIEGKDGKQYESVLVVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Specifications

Specifications

AAH47698
interleukin 7
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IL7
GST
3574
Wheat germ expression system
10 μg
IL-7
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers