missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZSWIM2 Partial ORF (NP_872327.2, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00151112-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025795

  • 518.16€ / 25µg

Estimated Shipment: 20-01-2022
Add to basket

Description

Description

Sequence: MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQL
Specifications

Specifications

NP_872327.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQL
RUO
ZSWIM2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
151112
ZSWIM2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC33890/ZZZ2
ZSWIM2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers