missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF444 Partial ORF (NP_060807.2, 38 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00055311-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025555

  • 341.70€ / 10µg

Estimated Shipment: 19-01-2022
Add to basket

Description

Description

ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM]

Sequence: LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMI
Specifications

Specifications

NP_060807.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMI
RUO
ZNF444
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
55311
ZNF444 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EZF-2/EZF2/FLJ11137/ZSCAN17
ZNF444
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers