missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF268 Partial ORF (NP_003406.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Accession Number	NP_003406.1
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	10795
Molecular Weight (g/mol)	35.64kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16103206 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00010795-Q01.25ug	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 14-10-2024 Log in to see stock.	Add to basket

16193196 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00010795-Q01.10ug	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 14-10-2024 Log in to see stock.	Add to basket

Description

Sequence: MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEKVLEWLFISQEQPKITKSWGPLSFMDVFVDF

Specifications

Accession Number	NP_003406.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	35.64kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	HZF3/MGC126498
Gene Symbol	ZNF268
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	10795
Name	ZNF268 (Human) Recombinant Protein (Q01)
Immunogen	MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEKVLEWLFISQEQPKITKSWGPLSFMDVFVDF
Regulatory Status	RUO
Common Name	ZNF268
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Description