Learn More
Abnova™ Human TRPM7 Partial ORF (NP_060142.2, 777 a.a. - 855 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
Accession Number | NP_060142.2 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 54822 |
Molecular Weight (g/mol) | 34.43kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16107756
|
Abnova™
H00054822-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 04-06-2024
Log in to see stock. |
|||||
16117756
|
Abnova™
H00054822-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 04-06-2024
Log in to see stock. |
|||||
Description
TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.[supplied by OMIM]
Sequence: KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVKSpecifications
NP_060142.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.43kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CHAK/CHAK1/FLJ20117/FLJ25718/LTRPC7/TRP-PLIK | |
TRPM7 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
54822 | |
TRPM7 (Human) Recombinant Protein (Q01) | |
KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK | |
RUO | |
TRPM7 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |