missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TGFBR2 Partial ORF (NP_001020018, 62 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007048-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034855

  • 518.16€ / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. [provided by RefSeq]

Sequence: IVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS
Specifications

Specifications

NP_001020018
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.18kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS
RUO
TGFBR2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7048
TGFBR2 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AAT3/FAA3/LDS1B/LDS2B/MFS2/RIIC/TAAD2/TGFR-2/TGFbeta-RII
TGFBR2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers