missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TBX6 Partial ORF (NP_004599, 191 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human TBX6 Partial ORF (NP_004599, 191 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7096762

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Specifications

Accession Number	NP_004599
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	6911
Molecular Weight (g/mol)	37.73kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16156315 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00006911-Q01.25UG	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

16146315 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00006911-Q01.10UG	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Add to basket

Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. [provided by RefSeq]

Sequence: SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE

Specifications

Accession Number	NP_004599
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.73kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	DFNB67
Gene Symbol	TBX6
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	6911
Name	TBX6 (Human) Recombinant Protein (Q01)
Immunogen	SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE
Regulatory Status	RUO
Common Name	TBX6
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Abnova™ Human TBX6 Partial ORF (NP_004599, 191 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents