missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human STRADB Partial ORF (NP_061041, 1 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_061041 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 55437 |
| Molecular Weight (g/mol) | 36.19kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16085555
|
Abnova™
H00055437-Q02.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
|
16095555
|
Abnova™
H00055437-Q02.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 31-05-2024
Log in to see stock. |
|||||
Description
This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. [provided by RefSeq]
Sequence: MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENSpecifications
| NP_061041 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.19kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ALS2CR2/CALS-21/ILPIP/ILPIPA/MGC102916/PAPK/PRO1038 | |
| STRADB | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 55437 | |
| STRADB (Human) Recombinant Protein (Q02) | |
| MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLEN | |
| RUO | |
| STRADB | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |