missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SOX5 Partial ORF (NP_008871.3, 181 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006660-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16014745

  • 341.70€ / 10µg

Estimated Shipment: 20-01-2022
Add to basket

Description

Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQ
Specifications

Specifications

NP_008871.3
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQ
RUO
SOX5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6660
SOX5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
L-SOX5/MGC35153
SOX5
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers