missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC9A6 Partial ORF (NP_006350, 602 a.a. - 669 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010479-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The SLC9A6 gene encodes a monovalent sodium-selective sodium/hydrogen exchanger (NHE) that is found in the membranes of intracellular organelles such as mitochondria and endosomes. NHEs participate in a wide array of essential cellular processes, including control of intracellular pH, maintenance of cellular volume, and reabsorption of sodium across renal, intestinal, and other epithelia.[supplied by OMIM]
Sequence: YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPASpecifications
| NP_006350 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.22kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA | |
| RUO | |
| SLC9A6 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10479 | |
| SLC9A6 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KIAA0267/MRSA/NHE6 | |
| SLC9A6 | |
| Recombinant | |
| wheat germ expression system |