missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC39A13 Partial ORF (NP_689477.2, 170 a.a. - 226 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00091252-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A13 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM]
Sequence: LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTSpecifications
| NP_689477.2 | |
| Liquid | |
| 91252 | |
| SLC39A13 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ25785 | |
| SLC39A13 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.01kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANT | |
| RUO | |
| SLC39A13 | |
| Wheat Germ (in vitro) | |
| GST |