missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC25A12 Partial ORF (NP_003696.2, 112 a.a. - 183 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008604-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in the gene encoding this protein may be associated with risk of autism. [provided by RefSeq]
Sequence: KEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSSpecifications
| NP_003696.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.66kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFS | |
| RUO | |
| SLC25A12 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8604 | |
| SLC25A12 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ARALAR/ARALAR1 | |
| SLC25A12 | |
| Recombinant | |
| wheat germ expression system |