missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC25A12 Partial ORF (NP_003696.2, 112 a.a. - 183 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008604-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158885

  • 545.00€ / 25µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in the gene encoding this protein may be associated with risk of autism. [provided by RefSeq]

Sequence: KEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFS
Specifications

Specifications

NP_003696.2
Liquid
8604
SLC25A12 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARALAR/ARALAR1
SLC25A12
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFS
RUO
SLC25A12
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers