missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SGK Partial ORF (AAH01263.1, 113 a.a. - 252 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006446-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034715

  • 518.16€ / 25µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq]

Sequence: LLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNS
Specifications

Specifications

AAH01263.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.14kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNS
RUO
SGK1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6446
SGK (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SGK
SGK1
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers