missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPA4 Partial ORF (NP_037479.1, 84 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00029935-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16015465

  • 518.16€ / 25µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. [provided by RefSeq]

Sequence: EKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESV
Specifications

Specifications

NP_037479.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESV
RUO
RPA4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
29935
RPA4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSU24186/MGC120333/MGC120334
RPA4
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers