missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RIN3 Partial ORF (NP_079108, 328 a.a. - 426 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079890-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16035655

  • 341.70€ / 10µg

Estimated Shipment: 19-01-2022
Add to basket

Description

Description

RIN3 is a member of the RIN family of Ras interaction-interference proteins, which are binding partners to the RAB5 small GTPases (see RAB5A; MIM 179512) (Kajiho et al., 2003 [PubMed 12972505]).[supplied by OMIM]

Sequence: GPPDHPNQPPMMTCERLPCPTAGLGPLREEAMKPGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSDGPEDTP
Specifications

Specifications

NP_079108
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GPPDHPNQPPMMTCERLPCPTAGLGPLREEAMKPGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSDGPEDTP
RUO
RIN3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79890
RIN3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp762H1613/FLJ11700/FLJ22439
RIN3
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers