missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RETN Partial ORF (AAI01555.1, 20 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056729-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16035595

  • 518.16€ / 25µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq]

Sequence: TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV
Specifications

Specifications

AAI01555.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.20kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV
RUO
RETN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
56729
RETN (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADSF/FIZZ3/MGC126603/MGC126609/RETN1/RSTN/XCP1
RETN
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers