missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human REG3A Partial ORF (NP_002571.1, 34 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005068-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034485

  • 341.70€ / 10µg

Estimated Shipment: 19-01-2022
Add to basket

Description

Description

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Multiple alternatively spliced transcript variants encoding the same protein have been described for this gene but the full length nature of some transcripts is not yet known. [provided by RefSeq]

Sequence: PSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
Specifications

Specifications

NP_002571.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.98kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
RUO
REG3A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5068
REG3A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HIP/INGAP/PAP/PAP-H/PAP1/PBCGF/REG-III/REG3
REG3A
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers