missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PIGW Partial ORF (NP_848612.2, 399 a.a. - 447 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00284098-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122727

  • 545.00€ / 25µg

Estimated Shipment: 07-10-2022
to see stock.
Add to basket

Description

Description

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]).[supplied by OMIM]

Sequence: KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK
Specifications

Specifications

NP_848612.2
Liquid
284098
PIGW (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ37433/Gwt1
PIGW
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.13kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK
RUO
PIGW
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers